| Basic Information | |
|---|---|
| Taxon OID | 3300007216 Open in IMG/M |
| Scaffold ID | Ga0103961_1248445 Open in IMG/M |
| Source Dataset Name | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1432 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.409238 | Long. (o) | 103.907928 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030736 | Metagenome / Metatranscriptome | 184 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103961_12484454 | F030736 | GAG | MKTTILKPACFTDFHWKIYQQELQTVKNSKTLDICFDCTVEYQSQMRKADKCAYPMKRLDKVTEYA* |
| ⦗Top⦘ |