NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103961_1245199

Scaffold Ga0103961_1245199


Overview

Basic Information
Taxon OID3300007216 Open in IMG/M
Scaffold IDGa0103961_1245199 Open in IMG/M
Source Dataset NameCombined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1701
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.409238Long. (o)103.907928Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002738Metagenome / Metatranscriptome533Y
F006619Metagenome / Metatranscriptome368Y
F015987Metagenome / Metatranscriptome250Y
F043890Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0103961_12451991F015987N/AMTQLTQAKLKDLNVLKLYEHYDALEKSLPLLTPESQELAKAELEACADLRSEKVDRIYYAIASHEDALERIKKEGEHITQAKRHHESQLRSLKGLLNYLRRVLPMDSNKITGRNYQFTLVKKKE
Ga0103961_12451993F002738N/AMLVTVMSIDTYGLPSEQYVKFFKDNVRLAARLYLDTCNILSAEGAGNVDFKTVLDMYQEAVYQTNDDCRKYQKANNPEAIKDTDLLGIYPSREEMMEEIKLVSAKVEALTDYVTELVKVTTKGLEGIAETLVD*
Ga0103961_12451994F043890N/AMQNTSSWATCNPNSIEKLQINCIDEEDGSMTIHIEWNETDPDLQWWTDLGEEGQKAFIIKALTDACDCYVD*
Ga0103961_12451996F006619N/ARQLSNLSDFASEIQGFKPWCIHLSWFNKYRELLCKRTEARNASPSGTPEKCVAWWYAPPVDHISDGRFVLLYTNSGAQAPLTHWRTYKPKEVFTQHDAWDLFFNMCDVGYVPFPGTALPQLKSALKKQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.