Scaffold Ga0103959_1209161

Overview

Basic Information

• Taxon OID: 3300007214
• Scaffold ID: Ga0103959_1209161
• Source Dataset Name: Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE), The Singapore Centre on Environmental Life Sciences Engineering
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1270
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.409238
  • Long. (^o): 103.907928

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043934	Metagenome	155	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103959_12091612	F043934	GGAG	VGRLIDVSTVDPRALNLKTLLDKVLEKVIEVYEEYNVPLPDRRFWTMGEPAIDCEQAVVSFIQVYLGRPGDEASEPQRCQMPRSAVLTISISREIPVVGVNGRAPTGEKIQEASEIAAVDAWMFMELINKLDQWTESEGDFGLGVIATADSTGFDGGFQTTAMQLTIAVP*