Scaffold Ga0103959_1181432

Overview

Basic Information

• Taxon OID: 3300007214
• Scaffold ID: Ga0103959_1181432
• Source Dataset Name: Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Singapore Centre on Environmental Life Sciences Engineering (SCELSE), The Singapore Centre on Environmental Life Sciences Engineering
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2025
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.409238
  • Long. (^o): 103.907928

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010760	Metagenome / Metatranscriptome	299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103959_11814326	F010760	N/A	KMGCACGCRGKYSYTTDGAKNFGPGYDVTDKVNERSVRIIAKKVLSNPFVKWQDNIAFVEDRVRNRFQMVVFKEQA*