NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103959_1036877

Scaffold Ga0103959_1036877


Overview

Basic Information
Taxon OID3300007214 Open in IMG/M
Scaffold IDGa0103959_1036877 Open in IMG/M
Source Dataset NameCombined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSingapore Centre on Environmental Life Sciences Engineering (SCELSE), The Singapore Centre on Environmental Life Sciences Engineering
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4408
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (23.08%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.409238Long. (o)103.907928Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016262Metagenome / Metatranscriptome248Y
F026511Metagenome / Metatranscriptome197N

Sequences

Protein IDFamilyRBSSequence
Ga0103959_103687712F026511N/AMDTTTLFEFVGEGKMQESNCIAIAFRRPTTGGNPVVNGYPLADGQTLRISQNVGDIDRTQYQINFAAGSGVCYVFRTLNEFCYATG*
Ga0103959_10368772F016262N/AMLKFNKNTLTEIASLGAGAVAGAYVSQKVLTKEDGTYLVGSGKTGKLVADVAPIAVGLFLQGQKNAMLKEAGKGMIAQAAGSLIKANFPALGVTGYDEPVMMSGTDGLDTGVDNPMISGTDNYGTDYSSVDAGEADF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.