Scaffold Ga0103273_1084131

Overview

Basic Information

• Taxon OID: 3300007200
• Scaffold ID: Ga0103273_1084131
• Source Dataset Name: Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1504
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freashwater Reservoir, Singapore (Monthly Sampling)

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.286816
  • Long. (^o): 103.77518

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001964	Metagenome	610	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103273_10841313	F001964	AGGAG	MSNRNLFAPPRFKLQISGALGWSDVKHRVVRYETTTYETRKEADKVARELNPGEYTQGRIRVVPVEMSEDYDVYPTPERTRENPKSAG*