| Basic Information | |
|---|---|
| Taxon OID | 3300007200 Open in IMG/M |
| Scaffold ID | Ga0103273_1084131 Open in IMG/M |
| Source Dataset Name | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Monthly Sampling-Site B) 9 sequencing projects |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1504 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Armatimonadetes → unclassified Armatimonadetes → Armatimonadetes bacterium Cent15-Ar3 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freashwater Reservoir, Singapore (Monthly Sampling) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.286816 | Long. (o) | 103.77518 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001964 | Metagenome | 610 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103273_10841313 | F001964 | AGGAG | MSNRNLFAPPRFKLQISGALGWSDVKHRVVRYETTTYETRKEADKVARELNPGEYTQGRIRVVPVEMSEDYDVYPTPERTRENPKSAG* |
| ⦗Top⦘ |