Scaffold Ga0099833_1000470

Overview

Basic Information

• Taxon OID: 3300007178
• Scaffold ID: Ga0099833_1000470
• Source Dataset Name: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - OCT_C_1 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 815
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.534
  • Long. (^o): -110.7978

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013155	Metagenome / Metatranscriptome	274	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099833_10004702	F013155	N/A	QVTMVVIALANLAVTVWLLRLLIPVWRTLKKVMSSVDQFDFDKLANQFLNGEKPLAESIHIKTTENKEENYKEIVVVRSFKRPLDPKEIQESFTRQMAEKLQ*