Basic Information | |
---|---|
Taxon OID | 3300007177 Open in IMG/M |
Scaffold ID | Ga0102978_1272130 Open in IMG/M |
Source Dataset Name | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering, Singapore Centre on Environmental Life Sciences Engineering (SCELSE) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2007 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freshwater Reservoir, Singapore (Diel Cycle) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.286816 | Long. (o) | 103.867024 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058798 | Metagenome / Metatranscriptome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102978_12721304 | F058798 | N/A | MAEHKVAGGTMLLYIDSTGVGDTYDTVVCLTSVGKSDSVTVVDASSACGPDKSPGTVEISYSFEGQHLQDPDGGKISGTSLRQLLRNKTTIAFSIEPASPVTGDEIEYGTGYISELSSTYAFDSVGTFTGTIQPYGTPTIEIEP* |
⦗Top⦘ |