Scaffold Ga0102976_1176416

Overview

Basic Information

• Taxon OID: 3300007169
• Scaffold ID: Ga0102976_1176416
• Source Dataset Name: Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The Singapore Centre on Environmental Life Sciences Engineering
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2007
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → unclassified Methylococcales → Methylococcales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freshwater Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location

• Location Name: Singapore
• Coordinates
  • Lat. (^o): 1.286816
  • Long. (^o): 103.867024

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101167	Metagenome / Metatranscriptome	102	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0102976_11764163	F101167	N/A	MPKAFRHKLYTLPSNFNEMNKFIETNKIQMMEHIVSSIEYAIDKKLSFVEIFSFKNSDFVVTLPENQFKENLENVYSYYIEKEKYELCVRVKSVENKLNSILDKITHEKKEKSTKRKK*