NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102976_1132084

Scaffold Ga0102976_1132084


Overview

Basic Information
Taxon OID3300007169 Open in IMG/M
Scaffold IDGa0102976_1132084 Open in IMG/M
Source Dataset NameCombined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Singapore Centre on Environmental Life Sciences Engineering
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4475
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freshwater Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.286816Long. (o)103.867024Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049574Metagenome146Y
F066738Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0102976_11320844F049574AGGCGGMNYRFLSMDSTIKAYNEAYKFKYHQYHQASKELARRDSIIAELNRQLIIKPTFKKMTQQDVFMTAYFVVFSSVLLYFTL*
Ga0102976_11320845F066738N/AMKHTILLIIAGIAVGVVLADQKKQSVQPDPVDAIIEKSKQTMRQASAVSARADKQVSESVSKMKQTIEVLEEEKEQLVEQVKVMKDEIVSIKSAPVQPFDVLAIGVPDTANRK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.