NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102976_1067177

Scaffold Ga0102976_1067177


Overview

Basic Information
Taxon OID3300007169 Open in IMG/M
Scaffold IDGa0102976_1067177 Open in IMG/M
Source Dataset NameCombined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe Singapore Centre on Environmental Life Sciences Engineering
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1273
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Marina Bay Freshwater Reservoir, Singapore (Diel Cycle)

Source Dataset Sampling Location
Location NameSingapore
CoordinatesLat. (o)1.286816Long. (o)103.867024Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006546Metagenome / Metatranscriptome370Y
F010915Metagenome / Metatranscriptome297Y
F037694Metagenome / Metatranscriptome167N

Sequences

Protein IDFamilyRBSSequence
Ga0102976_10671773F010915N/AMKQKLPPHNMIVVHQVGLDMYTLSYVKYVDHDVEQCIKYNLSAEDVAQFLGNN*
Ga0102976_10671774F037694N/AMLNKEQAFLVNEFIRKNATRNLWEVSDKLYKLLSEIKKAEENIQPENNETETAAA*
Ga0102976_10671775F006546N/AMKWKYIGNRTGDATKGEQYIVEADEYEEKYMKSYPYPQFAHVKVVQPPKPRSNFLTMKVGDTIKICNPYFDMHHYSHPGFVPVKE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.