NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099836_100129

Scaffold Ga0099836_100129


Overview

Basic Information
Taxon OID3300007164 Open in IMG/M
Scaffold IDGa0099836_100129 Open in IMG/M
Source Dataset NameIron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_top_diel_T=3 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)902
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Marsarchaeota → Candidatus Marsarchaeota group 2 → Candidatus Marsarchaeota G2 archaeon ECH_B_SAG-G16(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7315Long. (o)-110.7113Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026924Metagenome / Metatranscriptome196Y

Sequences

Protein IDFamilyRBSSequence
Ga0099836_1001293F026924AGGAGGMSVSKVCWRQHYKFEASKIVHLGRHGFHIPVIVYGHDPDPEKAQEDLCINMVGIYEPIGSFRENQLILPPKKGVRVEQEG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.