Scaffold Ga0099839_120121

Overview

Basic Information

• Taxon OID: 3300007161
• Scaffold ID: Ga0099839_120121
• Source Dataset Name: Iron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_top_diel_T=8 metaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 946
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.7315
  • Long. (^o): -110.7113

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011233	Metagenome / Metatranscriptome	293	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0099839_1201212	F011233	AGG	VSFSGNFTVLNGEFPGYFVSAAIGTTDPNFITRASADGLTVIEVTVGDLRDARVYRNQMGEPNILSYGAYIRDFPLPVYALSLNGDGLPFYQSIKIEIIPRNQPAFITGFAANIIEIYDVNLFKESVKEFFESITPSTVPPVVPTPPRFV