NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099839_112229

Scaffold Ga0099839_112229


Overview

Basic Information
Taxon OID3300007161 Open in IMG/M
Scaffold IDGa0099839_112229 Open in IMG/M
Source Dataset NameIron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_top_diel_T=8 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1050
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameYellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.7315Long. (o)-110.7113Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027904Metagenome / Metatranscriptome193N
F067921Metagenome / Metatranscriptome125N

Sequences

Protein IDFamilyRBSSequence
Ga0099839_1122291F027904GGAGGVECKYDPPTYDLFNLNNGSTLVGQSPVTLLYEGQPNAAVYAPPDLTLRAKQIIIQNATTSPITVQLLAVAAPNTSLPGPIPKTPPIPVNAGSAVTLSEEEWGIAVRSGYGLAAVSSAANSANVFVKC
Ga0099839_1122292F067921N/ASYSSSQHPDESSYTGFRVTKHNFTTLYYNFATEVSNFLPMAPFGGQASSTTSPPYITNFKFSLQLVQNVTDMFDLSRNYDAYQVFYGIAPSYLRTMLQIQQQFIAVLEQNINPSQSFVEMGIDGFQSPLFAPDPRTEFIVFSNLTYNMTLMNTATIPIMPAFNFVINRMTLEPLSKQEIKKAILAGFPVRTLGAVDSAIPVSRDNYPGLQTVTYKEVYGGGS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.