NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101672_1060912

Scaffold Ga0101672_1060912


Overview

Basic Information
Taxon OID3300007152 Open in IMG/M
Scaffold IDGa0101672_1060912 Open in IMG/M
Source Dataset NameSeawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', waterEBds3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)646
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location NameDobu 'bubble' site, Papua New Guinea
CoordinatesLat. (o)-9.73665Long. (o)150.867667Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047729Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0101672_10609122F047729N/AMSTSELNKLLNAQYHLDELEKMISGNKWYSHLYSHIAAVEGELQRQVAILENLPKAKTEVIEDTEKLYDVLEISTNGMNPPDASYTSLTRVVAAQKYESLLSEGVSPDDIKIKRVK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.