Scaffold Ga0101672_1033184

Overview

Basic Information

• Taxon OID: 3300007152
• Scaffold ID: Ga0101672_1033184
• Source Dataset Name: Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', waterEBds3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 864
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Dobu 'bubble' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.73665
  • Long. (^o): 150.867667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037415	Metagenome / Metatranscriptome	168	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101672_10331842	F037415	N/A	GTHMIMMEDDVLTQGKVKIPPEWECAGFDVPGNKIKPELLQYIKAKYGATPNVDWYGAGGGSIYNIETFLDNYHKIYDFIDYDFDYILKFLDYRFGWLDLYMQIAYFILGKDYSINSNLTEVWKTPNFKETDFSLVHAYKELY*