Scaffold Ga0101649_1028247

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101649_1028247

Scaffold Ga0101649_1028247

Overview

Basic Information
Taxon OID	3300007151 Open in IMG/M
Scaffold ID	Ga0101649_1028247 Open in IMG/M
Source Dataset Name	Marine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Dobu 'control', cg6adc
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	945
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location Name	Dobu 'control' site, Papua New Guinea
Coordinates	Lat. (^o)	-9.752083	Long. (^o)	150.854133	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065466	Metagenome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101649_10282471	F065466	N/A	YISQCMSTSRCRTMKTIVSLLLCLLFFPVEVHSQTVPYVSFMGTNLANHSYMDLTLVGNAVNGSNSVQCHTDLITCCSMTQGVDRGDWYFHNGERLNFSSDFVDIYQVRQAQRVDLSRRNNGDTSGIYRCSVETNAIHNDSGRETIYAGLYASGGELIHGKSSEYSQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.