NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101649_1023292

Scaffold Ga0101649_1023292


Overview

Basic Information
Taxon OID3300007151 Open in IMG/M
Scaffold IDGa0101649_1023292 Open in IMG/M
Source Dataset NameMarine sponge Cinachyra sp. microbiome, Papua New Guinea CO2seep, Dobu 'control', cg6adc
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)1023
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Cinachyra Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location NameDobu 'control' site, Papua New Guinea
CoordinatesLat. (o)-9.752083Long. (o)150.854133Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065466Metagenome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0101649_10232921F065466N/ASVLLCLLSALVEVHSQTVPYVSFMGTNLMNHSYVDLTQVGNALDGSDSVQCHTDLGTCCSDSQGADRGDWYFPNGERLKFNMDSQNIYEKRAAQQVDLRRKNNGDTSGIYCCTIRTNAVQRDNVARETVYAGLYASGGKCSSTDVQLIL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.