NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101550_1096716

Scaffold Ga0101550_1096716


Overview

Basic Information
Taxon OID3300007148 Open in IMG/M
Scaffold IDGa0101550_1096716 Open in IMG/M
Source Dataset NameMarine sponge Stylissa sp. associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - st43is
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)505
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Sylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location NameUpa-Upasina (low pH), Papua New Guinea
CoordinatesLat. (o)-9.8241Long. (o)150.825833Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015565Metagenome / Metatranscriptome253Y

Sequences

Protein IDFamilyRBSSequence
Ga0101550_10967163F015565N/AKTIVKESCKFELAHLKKNEKQFGCLATFWFSTFAMLFSTTGCVVSHENT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.