| Basic Information | |
|---|---|
| Taxon OID | 3300007144 Open in IMG/M |
| Scaffold ID | Ga0101670_1045095 Open in IMG/M |
| Source Dataset Name | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', waterEBic1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 723 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Upa-Upasina 'control' site, Papua New Guinea | |||||||
| Coordinates | Lat. (o) | -9.828217 | Long. (o) | 150.820517 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F103871 | Metagenome / Metatranscriptome | 101 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101670_10450951 | F103871 | AGG | MVQIPGLILDCSKKKPPAKAGLNDLCALAGFIKRPQVALTQRYAIYSEIQDFVNYQLN |
| ⦗Top⦘ |