NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101670_1035371

Scaffold Ga0101670_1035371


Overview

Basic Information
Taxon OID3300007144 Open in IMG/M
Scaffold IDGa0101670_1035371 Open in IMG/M
Source Dataset NameSeawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', waterEBic1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of New South Wales
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)808
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location NameUpa-Upasina 'control' site, Papua New Guinea
CoordinatesLat. (o)-9.828217Long. (o)150.820517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001026Metagenome / Metatranscriptome802Y
F094001Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0101670_10353712F001026GAGGMAKHTLELDDLELTALITHLEGQSEMMCESRLNCSNPSELPDREEVLLNLVYAKAFTIGWDAHINPKVDFDLHKNEDRIFKYK*
Ga0101670_10353713F094001AGGAGGMNELRLPSDTPIQYEEGLWELCTDKAYEMMKHKRQFLDDDIFDYQIEYWTNKIFEANSHLRGID*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.