Scaffold Ga0101671_1060185

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101671_1060185

Scaffold Ga0101671_1060185

Overview

Basic Information
Taxon OID	3300007133 Open in IMG/M
Scaffold ID	Ga0101671_1060185 Open in IMG/M
Source Dataset Name	Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', water-ds
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	553
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location Name	Dobu 'bubble' site, Papua New Guinea
Coordinates	Lat. (^o)	-9.73665	Long. (^o)	150.867667	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072012	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101671_10601851	F072012	N/A	LSTLSKFNEYFNEISKDTKLNNIMVDHSHAGMNYTVLNYKRGDWYLSPFMYENMAIYDDSLKVESFDDVVPITESQINRAKGTECEDCPLFFSCYNRKIILLRDYLGVKHCIAPKENMLNNIHNYNAPAQTMYQWDGYSVENDKRGYRKKFLVTEDNDPELERIKNISYVK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.