NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102640_1000385

Scaffold Ga0102640_1000385


Overview

Basic Information
Taxon OID3300007119 Open in IMG/M
Scaffold IDGa0102640_1000385 Open in IMG/M
Source Dataset NameHuman supragingival plaque microbial communities from NIH, USA - visit 2, subject 763860675
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)31204
Total Scaffold Genes34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (8.82%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054111Metagenome140N

Sequences

Protein IDFamilyRBSSequence
Ga0102640_100038511F054111GGAMNKPLDNITHEVFLKLMEHLKNLQEFTFLEYIIAPEADIFYFNFMKKTVKIKWGLDYGLSLETKALYTSDKDLFLNILHKEILSLENQ*
Ga0102640_100038513F054111N/AMNKSLESITHEEFLKLMERLKNLQELTFLEYIMAPEADIFYFNFMEKTVKIKWDLDYGLFLETEALSTADRDLFLNILNKEILFLI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.