Scaffold Ga0101549_1112549

Overview

Basic Information

• Taxon OID: 3300007117
• Scaffold ID: Ga0101549_1112549
• Source Dataset Name: Marine sponge Stylissa sp. associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - st20is
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.40556
  • Long. (^o): 150.816667

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024258	Metagenome / Metatranscriptome	206	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101549_11125491	F024258	GAG	MHLPIAHVNYACAIGIRLNLDLLCVAQNGVVLELRRIEASQNCHSCQFANKRAERGYYDESDIVLCVK*