Basic Information | |
---|---|
Taxon OID | 3300007117 Open in IMG/M |
Scaffold ID | Ga0101549_1069129 Open in IMG/M |
Source Dataset Name | Marine sponge Stylissa sp. associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - st20is |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of New South Wales |
Sequencing Status | Finished |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 683 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Upa-Upasina, Papua New Guinea | |||||||
Coordinates | Lat. (o) | -9.40556 | Long. (o) | 150.816667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023046 | Metagenome / Metatranscriptome | 211 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0101549_10691291 | F023046 | N/A | IHFGINGVRNKRSHLVGPPFPEFKARFSATAGWHFSSDLARRLLIGGCGQSTYLLSMAEITSGSSFEHNNRTEQKLGYV* |
⦗Top⦘ |