Scaffold Ga0101667_1109968

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101667_1109968

Scaffold Ga0101667_1109968

Overview

Basic Information
Taxon OID	3300007116 Open in IMG/M
Scaffold ID	Ga0101667_1109968 Open in IMG/M
Source Dataset Name	Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of New South Wales
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	502
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location
Location Name	Upa-Upasina 'bubble' site, Papua New Guinea
Coordinates	Lat. (^o)	-9.8241	Long. (^o)	150.825833	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104045	Metagenome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101667_11099682	F104045	AGGAG	MSVDGKEHWLENRAIELFEEMQRKNPHLSWKEIDELCYKQAEEDYMNQPEVDYKKIQEESEI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.