Scaffold Ga0101667_1034461

Overview

Basic Information

• Taxon OID: 3300007116
• Scaffold ID: Ga0101667_1034461
• Source Dataset Name: Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 883
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina 'bubble' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.8241
  • Long. (^o): 150.825833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010536	Metagenome / Metatranscriptome	302	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101667_10344613	F010536	GAGG	MIDVMLSKATEGMLIAELLNRRNDKEVPLFMGKSILLPSGQQQLIAILPNIQILTNVEQEEE*