| Basic Information | |
|---|---|
| Taxon OID | 3300007114 Open in IMG/M |
| Scaffold ID | Ga0101668_1050247 Open in IMG/M |
| Source Dataset Name | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 864 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Upa-Upasina 'bubble' site, Papua New Guinea | |||||||
| Coordinates | Lat. (o) | -9.8241 | Long. (o) | 150.825833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007801 | Metagenome / Metatranscriptome | 344 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101668_10502473 | F007801 | AGGAG | MAIHDLTKKTRASTGQRIIRLGPADNTMRVIKLERRLDDQEKKLDKILNLLQHGNNLPN |
| ⦗Top⦘ |