Scaffold Ga0101666_1005436

Overview

Basic Information

• Taxon OID: 3300007113
• Scaffold ID: Ga0101666_1005436
• Source Dataset Name: Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1966
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina 'bubble' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.8241
  • Long. (^o): 150.825833

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033465	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101666_10054366	F033465	N/A	EFIWFPIVLCCIVAMIGEHSNPRGMNIFWYKLTIKTREYTKALIEYDSGNNSGNGPR*