| Basic Information | |
|---|---|
| Taxon OID | 3300007112 Open in IMG/M |
| Scaffold ID | Ga0101560_1003313 Open in IMG/M |
| Source Dataset Name | Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Dobu 'control', st5dc |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2322 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (28.57%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Dobu 'control' site, Papua New Guinea | |||||||
| Coordinates | Lat. (o) | -9.752083 | Long. (o) | 150.854133 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072439 | Metagenome | 121 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101560_10033135 | F072439 | N/A | MVLPSTKLGYTLGVKRDRDIISPRERQKASPFKGRRTRMAGDKRIDLFAVRPDEAPFSYTKGTNLPKRFTQTLDIPIEREEED* |
| ⦗Top⦘ |