NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102634_102215

Scaffold Ga0102634_102215


Overview

Basic Information
Taxon OID3300007111 Open in IMG/M
Scaffold IDGa0102634_102215 Open in IMG/M
Source Dataset NameHuman stool microbial communities from NIH, USA - visit 1, subject 158944319
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9166
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (41.18%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083452Metagenome113N
F102167Metagenome102N

Sequences

Protein IDFamilyRBSSequence
Ga0102634_1022155F083452GGAMSGRIKIKSKDKDKRPKIDVFKVIESRFKNMNELRDLIDMDPRKGLVRIRDGAGFREVERGGCLHRNYLNLLEEELGAKLSIDLIERYIKR*
Ga0102634_1022159F102167N/AMDINQIKKYLPLGWDVVDLIDHGIIDLDIMNGKMMGEYVAVLMIKSYDKTNDHILTAFSFHDKDMDKLRMLIGNAIMAVGYRNNPLTGDGNTAIK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.