Scaffold Ga0102541_1394804

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102541_1394804

Scaffold Ga0102541_1394804

Overview

Basic Information
Taxon OID	3300007102 Open in IMG/M
Scaffold ID	Ga0102541_1394804 Open in IMG/M
Source Dataset Name	Combined Assembly of Marine Sediment Inoculum and Enrichments
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	QB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	611
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment → Sediment Microbial Communities Enriched With Perchlorate Of Varying Salinity From San Francisco Bay Shoreline

Source Dataset Sampling Location
Location Name	Berkeley Marina, Berkeley, California, USA
Coordinates	Lat. (^o)	37.8629	Long. (^o)	-122.3132	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084254	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102541_13948041	F084254	N/A	ILAEVIRQSKRHPRADQVASALAIRGLPIAEKDVMTVFDHYDIEKKTPDSH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.