Scaffold Ga0102541_1379906

Overview

Basic Information

• Taxon OID: 3300007102
• Scaffold ID: Ga0102541_1379906
• Source Dataset Name: Combined Assembly of Marine Sediment Inoculum and Enrichments
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: QB3 Vincent J. Coates Genomics Sequencing Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 512
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment → Sediment Microbial Communities Enriched With Perchlorate Of Varying Salinity From San Francisco Bay Shoreline

Source Dataset Sampling Location

• Location Name: Berkeley Marina, Berkeley, California, USA
• Coordinates
  • Lat. (^o): 37.8629
  • Long. (^o): -122.3132
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045766	Metagenome	152	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102541_13799061	F045766	AGG	MCDVKEQLERVIARMQVIQRAIGASGQPASMFELQELKDLGREYARLVDELANTLTDPSRG*