Scaffold Ga0102541_1336079

Overview

Basic Information

• Taxon OID: 3300007102
• Scaffold ID: Ga0102541_1336079
• Source Dataset Name: Combined Assembly of Marine Sediment Inoculum and Enrichments
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: QB3 Vincent J. Coates Genomics Sequencing Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2197
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment → Sediment Microbial Communities Enriched With Perchlorate Of Varying Salinity From San Francisco Bay Shoreline

Source Dataset Sampling Location

• Location Name: Berkeley Marina, Berkeley, California, USA
• Coordinates
  • Lat. (^o): 37.8629
  • Long. (^o): -122.3132
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054047	Metagenome / Metatranscriptome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102541_13360791	F054047	N/A	LGSNIGHCLFVGWVEHLDIFCWVSFLYPIYLPAIFVLSAKPNKMAEDRTIPEYCNHTGNQS*