| Basic Information | |
|---|---|
| Taxon OID | 3300007102 Open in IMG/M |
| Scaffold ID | Ga0102541_1258322 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Marine Sediment Inoculum and Enrichments |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | QB3 Vincent J. Coates Genomics Sequencing Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 641 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment → Sediment Microbial Communities Enriched With Perchlorate Of Varying Salinity From San Francisco Bay Shoreline |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Berkeley Marina, Berkeley, California, USA | |||||||
| Coordinates | Lat. (o) | 37.8629 | Long. (o) | -122.3132 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F084253 | Metagenome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102541_12583222 | F084253 | N/A | MSNFVLIKAAQGFAVRRTSVRRSRKPAENAEQDKKGHLWMETNK |
| ⦗Top⦘ |