Basic Information | |
---|---|
Taxon OID | 3300007102 Open in IMG/M |
Scaffold ID | Ga0102541_1053891 Open in IMG/M |
Source Dataset Name | Combined Assembly of Marine Sediment Inoculum and Enrichments |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | QB3 Vincent J. Coates Genomics Sequencing Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 510 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment → Sediment Microbial Communities Enriched With Perchlorate Of Varying Salinity From San Francisco Bay Shoreline |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Berkeley Marina, Berkeley, California, USA | |||||||
Coordinates | Lat. (o) | 37.8629 | Long. (o) | -122.3132 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F103272 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102541_10538912 | F103272 | AGG | MNYLTDREKELIKYKKQYLNLVYKITQLQLSGEDPPEELLKKAQNIGRTAKIPEMFLKSILLSLW* |
⦗Top⦘ |