Scaffold Ga0101564_1023724

Overview

Basic Information

• Taxon OID: 3300007099
• Scaffold ID: Ga0101564_1023724
• Source Dataset Name: Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', stU
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 835
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina 'control' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.752083
  • Long. (^o): 150.854133

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023046	Metagenome / Metatranscriptome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101564_10237243	F023046	N/A	LAGPPFPEFKARFSATADWHFSSDLARRSLIGGCGHSHVSEITSGSSFEHNPIEQKLGYV