Scaffold Ga0102532_1178590

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102532_1178590

Scaffold Ga0102532_1178590

Overview

Basic Information
Taxon OID	3300007094 Open in IMG/M
Scaffold ID	Ga0102532_1178590 Open in IMG/M
Source Dataset Name	Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	The Singapore Centre on Environmental Life Sciences Engineering
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1532
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Singapore - A Non-Axenic Oscillatoriales Culture (M13A)

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.3991438	Long. (^o)	103.77518	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002540	Metagenome / Metatranscriptome	550	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102532_11785902	F002540	AGGAG	MPAYEATPEELDKYGAGLNIWQQLALLQAWSPLIAYGQRLVGESDPYKKSLIVAEAAEWVASKTDARLDDQLAKLLGDIIRTPQGEALVRWALLQTEAAR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.