Basic Information | |
---|---|
Taxon OID | 3300007094 Open in IMG/M |
Scaffold ID | Ga0102532_1143063 Open in IMG/M |
Source Dataset Name | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5432 |
Total Scaffold Genes | 12 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Singapore - A Non-Axenic Oscillatoriales Culture (M13A) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Singapore | |||||||
Coordinates | Lat. (o) | 1.3991438 | Long. (o) | 103.77518 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F058739 | Metagenome / Metatranscriptome | 134 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102532_11430636 | F058739 | GAGG | MIDPKLIDVFPDEHDGYPDHLAAEDTSDALRSACGEASRDFPESMWIEPREWAERAAENDRHGLWAMNFLDRFTNQTPTHECTCHSLRANFEAARNRARGLIYPDGPKAGERYAESATSGSVWLSPLSVYAEANPDRWGGANVRQVLEIAVRRGMLPDVRQPRDYGFIHAIPGTSGKGNNNQAGGAWIPVSRFPAGWQETARRFRPLEVIFPDSYEEAVCCVLNGLVVSVGRRGHAVPWARWVADQRLMAYPDSYDITRYDSDRTARSAWKGSFAIASVTLPDDWSRPAG* |
⦗Top⦘ |