NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0075435_101070190

Scaffold Ga0075435_101070190


Overview

Basic Information
Taxon OID3300007076 Open in IMG/M
Scaffold IDGa0075435_101070190 Open in IMG/M
Source Dataset NamePopulus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)705
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere → Populus Root And Rhizosphere Microbial Communities From Tennessee, Usa

Source Dataset Sampling Location
Location NameUSA: Tennessee
CoordinatesLat. (o)35.8444Long. (o)-83.9599Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012609Metagenome / Metatranscriptome279Y

Sequences

Protein IDFamilyRBSSequence
Ga0075435_1010701901F012609N/ASDGQVVDRALIQFICIRKTHRRKAPLDPSSPYNIAEEGGWAYCPGGEADGHRWFKTGGITRAALAKFDWPDDEEAEP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.