NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102624_104746

Scaffold Ga0102624_104746


Overview

Basic Information
Taxon OID3300007051 Open in IMG/M
Scaffold IDGa0102624_104746 Open in IMG/M
Source Dataset NameCombined Assembly of 100bp T18 (BES) Gp0123708, Gp0123962, Gp0123963
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2256
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Source Dataset Sampling Location
Location NameUK
CoordinatesLat. (o)54.971158Long. (o)-1.703654Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020363Metagenome / Metatranscriptome224Y

Sequences

Protein IDFamilyRBSSequence
Ga0102624_1047461F020363N/ANKRAEIGAHLDCRLDFFTDNALPLLALTFGGMCSWRRVAVARVFALVMRCRVKRLLLYSRVGKNRDTSRESPAAAGAGRTTDHLIVLFSQKVLAVRKANCIYRPVSHS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.