Scaffold Ga0101554_1002700

Overview

Basic Information

• Taxon OID: 3300007049
• Scaffold ID: Ga0101554_1002700
• Source Dataset Name: Marine sponge Stylissa sp. microbiome, Papua New Guinea CO2seep, Upa-Upasina 'control', st32ic
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of New South Wales
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 1623
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps

Source Dataset Sampling Location

• Location Name: Upa-Upasina 'control' site, Papua New Guinea
• Coordinates
  • Lat. (^o): -9.828217
  • Long. (^o): 150.820517

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068722	Metagenome / Metatranscriptome	124	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0101554_10027002	F068722	AGGAG	MKIEFDYKQGEWIQLKAYLFPYLHKSELVQDFVKKVNTKTRLRPMK*