Basic Information | |
---|---|
Taxon OID | 3300007038 Open in IMG/M |
Scaffold ID | Ga0102672_107903 Open in IMG/M |
Source Dataset Name | Non-marine hypersaline water viral communities from A?ana, Logro?o, Spain -Vir_A?ana_balsa_PRE |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Alicante |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1132 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Paracoccus → Paracoccus suum | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Añana | |||||||
Coordinates | Lat. (o) | 42.80111387 | Long. (o) | -2.985507 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F078533 | Metagenome / Metatranscriptome | 116 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102672_1079033 | F078533 | GGA | MTPAEFKSARNALCLSQRDLAEVWGMGQNGERTIRRWEQGDVSVNPIAAYCITLMMGRA* |
⦗Top⦘ |