NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102672_101192

Scaffold Ga0102672_101192


Overview

Basic Information
Taxon OID3300007038 Open in IMG/M
Scaffold IDGa0102672_101192 Open in IMG/M
Source Dataset NameNon-marine hypersaline water viral communities from A?ana, Logro?o, Spain -Vir_A?ana_balsa_PRE
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Alicante
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3248
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain

Source Dataset Sampling Location
Location NameAñana
CoordinatesLat. (o)42.80111387Long. (o)-2.985507Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096721Metagenome104N

Sequences

Protein IDFamilyRBSSequence
Ga0102672_1011923F096721N/AVIPPSDFGRMVGSIFAYIEDGIPEQALFDLTIIAQNAKDFEAGMSALVELGDIINDHYSEREPDYGPYDEIEDSIWGTEGDDFDPPEDWFTDGGPFGPDEDL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.