NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0080086_106608

Scaffold Ga0080086_106608


Overview

Basic Information
Taxon OID3300007020 Open in IMG/M
Scaffold IDGa0080086_106608 Open in IMG/M
Source Dataset NameNon-marine hypersaline water viral communities from Mallorca, Spain, 2014 - E1 T-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Alicante
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)796
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Mallorca 2014 (Spain)E1

Source Dataset Sampling Location
Location NameSalinas de Campos (Mallorca)
CoordinatesLat. (o)39.338015Long. (o)3.051796Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056354Metagenome137N

Sequences

Protein IDFamilyRBSSequence
Ga0080086_1066082F056354GGAGGMILPVFIALSIAAVVITGLAIRGDIPELLGAAVAAIMSIVAGINALDLFVITNSGNVKDIEPQTDIALILLVMFVINLIFIFDRAFSGE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.