Scaffold Ga0080086_100805

Overview

Basic Information

• Taxon OID: 3300007020
• Scaffold ID: Ga0080086_100805
• Source Dataset Name: Non-marine hypersaline water viral communities from Mallorca, Spain, 2014 - E1 T-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Alicante
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1937
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kirjokansivirales → Haloferuviridae → unclassified Haloferuviridae → environmental Halophage eHP-39 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Mallorca 2014 (Spain)E1

Source Dataset Sampling Location

• Location Name: Salinas de Campos (Mallorca)
• Coordinates
  • Lat. (^o): 39.338015
  • Long. (^o): 3.051796

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054456	Metagenome	140	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0080086_1008054	F054456	N/A	MAYNPNLDFSTDTEKLSPQQAHDRWEDVTNLDTPELERLEDSRRNELYLDAAEGNQGEDNPPIPGGPLADAQHLASTPRDEWGPDERAEAEEALNFLSRTLPQFEQSEGEALIEDEPPKIHKDELSIMRWGVDPNPEDDFL*