Scaffold Ga0098064_100539

Overview

Basic Information

• Taxon OID: 3300006988
• Scaffold ID: Ga0098064_100539
• Source Dataset Name: Marine viral communities from Cariaco Basin, Caribbean Sea - 24B_WHOI_OMZ_CsCl
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8650
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Caribbean Sea: Cariaco Basin
• Coordinates
  • Lat. (^o): 10.847
  • Long. (^o): -65.114
  • Depth (m): 237

Associated Families

Family	Category	Number of Sequences	3D Structure?
F097171	Metagenome / Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0098064_1005396	F097171	N/A	MLTFIEKKEHVLNVLLRAATLSPTEKLVAVAMVFKINDNGVVDLRMKEIAELSSLTVRGLREVLKRLQAKQIFDTRYHNAKKTYYFVMWRML*