| Basic Information | |
|---|---|
| Taxon OID | 3300006966 Open in IMG/M |
| Scaffold ID | Ga0080110_100743 Open in IMG/M |
| Source Dataset Name | Non-marine hypersaline water viral communities from Mallorca, Spain, 2014 - E1 T11 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Alicante |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1623 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidetes Order II. Incertae sedis → Rhodothermaceae → Salinibacter → Salinibacter ruber | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Mallorca 2014 (Spain)E1 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Salinas de Campos (Mallorca) | |||||||
| Coordinates | Lat. (o) | 39.338015 | Long. (o) | 3.051796 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049200 | Metagenome | 147 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0080110_1007431 | F049200 | N/A | DLSLGQRLALPYESDDTSISVPAEITGLGLPAVRVETDSGETYIRHAKDVTDWTRHLRHA |
| ⦗Top⦘ |