Scaffold Ga0079219_11724688

Overview

Basic Information

• Taxon OID: 3300006954
• Scaffold ID: Ga0079219_11724688
• Source Dataset Name: Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 582
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 33.8834
  • Long. (^o): -83.4195

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007400	Metagenome / Metatranscriptome	352	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079219_117246881	F007400	GAG	MPERLATFTGEVRCERAPAVPGLTLRGVAAGSPAEPASLAFSGFAPADLPEKLEDAVVEHLGGAQYRIAERTRSWLITASAVHLHREIAAQFYQAIPPRRAPWAKRVFWRAVL