| Basic Information | |
|---|---|
| Taxon OID | 3300006954 Open in IMG/M |
| Scaffold ID | Ga0079219_10372059 Open in IMG/M |
| Source Dataset Name | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 930 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Georgia | |||||||
| Coordinates | Lat. (o) | 33.8834 | Long. (o) | -83.4195 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014526 | Metagenome / Metatranscriptome | 262 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079219_103720592 | F014526 | GGAGG | MEKGELRAAISRGYREMSELTKVKCGGDKCPGVGNRAYRCCDRMHCQMTIDHAYKDWGIRLPSTGHQLPLMGPTGCTALPHLRPWCTLHQCQIQETGSTKDRGWDAKYFRIRNKLTRLEQQLAAM* |
| ⦗Top⦘ |